PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00031245-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 209aa    MW: 22810.7 Da    PI: 4.2136
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00031245-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.83.4e-101443130
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                        +g+WT+eEd++l+ +++++G g+W++ +++
  WALNUT_00031245-RA 14 KGPWTPEEDQKLLAYIEEHGHGSWRALPAK 43
                        79***********************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-13543IPR009057Homeodomain-like
PROSITE profilePS500907.306940IPR017877Myb-like domain
SuperFamilySSF466891.08E-81142IPR009057Homeodomain-like
PfamPF002497.2E-91445IPR001005SANT/Myb domain
CDDcd001673.35E-61643No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRSPCCDKV GLKKGPWTPE EDQKLLAYIE EHGHGSWRAL PAKAENAPPV MTTAGIGETS  60
MPLIEFVGTT SGSSETGIVK DEGEQDWKPF ENSTHWSEYK EGMENSLSFT SNLHDISMSM  120
EGTWTSPESL RTSRGHVHFG NVMGDQEGFT NLLLNNFDDH QSLSDGGDDS ENGSGSGSGS  180
GSDYYEDNKN YWNSILNLVN SSPSDSPMF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150372e-31AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032600.13e-68Myb domain protein 106
TrEMBLA0A061EF184e-68A0A061EF18_THECC; Myb domain protein 106
STRINGPOPTR_0017s12230.15e-48(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.14e-25myb domain protein 16